PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00880-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 313aa    MW: 34641.7 Da    PI: 7.2589
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00880-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.32.7e-4371061100
                                                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57 
                                                           +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda
  augustus_masked-scaffold00880-abinit-gene-0.0-mRNA-1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNAAQREDA 63 
                                                           7******************************************************** PP

                                                DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                           ++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l  +k+e
  augustus_masked-scaffold00880-abinit-gene-0.0-mRNA-1  64 VNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQTDLYNAKKE 106
                                                           ************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9276107IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKQVQTDL YNAKKELATY IGPQAMLPIL  120
QPPGFIPQQH HPANPSSSAV ALPYNMSPAM MGIPTAGATH SGQMMIRETQ QQQQQQQQHH  180
QHHIFEAQQL AAAVAAREQH EIYRNYEQQQ QQQPELVRFN SGFDPASAGS VTASGYNHMN  240
AAAMSPSLAL GTYETPYQIQ TQQGAEHHHP HHQLQAQLLL QPQQTQAQQQ GQQTQPPQPK  300
SESEEGRSVG PSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491765.11e-121PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ38e-92LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-129A0A0B0PS92_G
STRINGVIT_07s0197g00020.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-84ASYMMETRIC LEAVES 2-like 1